| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (2 species) |
| Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
| Domain d2qbds1: 2qbd S:2-80 [150451] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbdt1, d2qbdu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOPe Domain Sequences for d2qbds1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbds1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr
Timeline for d2qbds1: