Lineage for d2qbdf1 (2qbd F:1-100)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909830Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1909831Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1909832Protein Ribosomal protein S6 [54997] (4 species)
  7. 1909835Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1909838Domain d2qbdf1: 2qbd F:1-100 [150439]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbdf1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qbdf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbdf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qbdf1:

Click to download the PDB-style file with coordinates for d2qbdf1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdf1: