SCOP 1.61: Domain d2spm__: 2spm -

Lineage for d2spm__ (2spm -)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d2spm__: 2spm - [15045]

Details for d2spm__

PDB Entry: 2spm, 1.7 Å

PDB Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate

SCOP Domain Sequences for d2spm__:

Sequence; same for both SEQRES and ATOM records:

>d2spm__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2spm__:

• d2spm__ first appeared (with stable ids) in SCOP 1.55
  
• d2spm__ appears in SCOP 1.59
  
• d2spm__ appears in SCOP 1.63
  
• d2spm__ appears in the current release, SCOPe 2.08, called d2spma_