Lineage for d1vxd__ (1vxd -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (18 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries) 
Domain d1vxd__: 1vxd - [15042]
Details for d1vxd__
PDB Entry: 1vxd (more details), 1.7 Å
PDB Description: native sperm whale myoglobin
SCOP Domain Sequences for d1vxd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vxd__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1vxd__:
Click to download the PDB-style file with coordinates for d1vxd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vxd__:
- d1vxd__ first appeared (with stable ids) in SCOP 1.55
- d1vxd__ appears in SCOP 1.59
- d1vxd__ appears in SCOP 1.63
- d1vxd__ appears in the current release, SCOPe 2.08, called d1vxda_
View in 3D