Lineage for d2qbch2 (2qbc H:1-58)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214149Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1214150Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1214151Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 1214152Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 1214160Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 1214172Domain d2qbch2: 2qbc H:1-58 [150413]
    Other proteins in same PDB: d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcc2, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbco1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1
    automatically matched to 2AW4 H:1-58
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbch2

PDB Entry: 2qbc (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 50S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qbch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbch2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2qbch2:

Click to download the PDB-style file with coordinates for d2qbch2.
(The format of our PDB-style files is described here.)

Timeline for d2qbch2: