SCOP 1.63: Domain d1mbd__: 1mbd -

Lineage for d1mbd__ (1mbd -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d1mbd__: 1mbd - [15033]
   complexed with hem, so4

Details for d1mbd__

PDB Entry: 1mbd, 1.4 Å

PDB Description: x-ray structure of sperm whale deoxymoglobin refined at 1.4a resolution

SCOP Domain Sequences for d1mbd__:

Sequence; same for both SEQRES and ATOM records:

>d1mbd__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1mbd__:

• d1mbd__ first appeared (with stable ids) in SCOP 1.55
  
• d1mbd__ appears in SCOP 1.61
  
• d1mbd__ appears in SCOP 1.65
  
• d1mbd__ appears in the current release, SCOPe 2.08, called d1mbda_