Class j: Peptides [58231] (151 folds) |
Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) |
Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
Protein Ribosomal protein S21, RpsU [161310] (1 species) |
Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
Domain d2qanu1: 2qan U:3-53 [150287] Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1 protein/RNA complex; complexed with mg, nmy protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qan (more details), 3.21 Å
SCOPe Domain Sequences for d2qanu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qanu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2qanu1: