Lineage for d2qanp1 (2qan P:1-80)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200238Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1200239Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1200240Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1200241Protein Ribosomal protein S16 [54567] (3 species)
  7. 1200244Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1200245Domain d2qanp1: 2qan P:1-80 [150282]
    Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1
    automatically matched to 2AVY P:1-82
    protein/RNA complex; complexed with mg, nmy

Details for d2qanp1

PDB Entry: 2qan (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2qanp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qanp1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnk

SCOPe Domain Coordinates for d2qanp1:

Click to download the PDB-style file with coordinates for d2qanp1.
(The format of our PDB-style files is described here.)

Timeline for d2qanp1: