SCOPe 2.08: Domain d2qa4u1: 2qa4 U:4-56

Lineage for d2qa4u1 (2qa4 U:4-56)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d2qa4u1: 2qa4 U:4-56 [150194]
   Other proteins in same PDB: d2qa421, d2qa4b1, d2qa4c1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4k1, d2qa4m1, d2qa4p1, d2qa4r1, d2qa4s1, d2qa4y1, d2qa4z1
   automatically matched to d1w2bt_
   complexed with cd, cl, k, mg, na

Details for d2qa4u1

PDB Entry: 2qa4, 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit

PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d2qa4u1:

Sequence; same for both SEQRES and ATOM records:

>d2qa4u1 i.1.1.2 (U:4-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d2qa4u1:

• d2qa4u1 first appeared in SCOP 1.75
  
• d2qa4u1 appears in SCOPe 2.07