SCOPe 2.08: Domain d2qa4m1: 2qa4 M:1-194

Lineage for d2qa4m1 (2qa4 M:1-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d2qa4m1: 2qa4 M:1-194 [150186]
   Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
   automatically matched to d1s72m_
   complexed with cd, cl, k, mg, na

Details for d2qa4m1

PDB Entry: 2qa4, 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d2qa4m1:

Sequence; same for both SEQRES and ATOM records:

>d2qa4m1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

Timeline for d2qa4m1:

• d2qa4m1 first appeared in SCOP 1.75
  
• d2qa4m1 appears in SCOPe 2.07