SCOPe 2.07: Domain d2q9ob3: 2q9o B:344-559

Lineage for d2q9ob3 (2q9o B:344-559)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (9 PDB entries)

8. Domain d2q9ob3: 2q9o B:344-559 [150154]
   automated match to d1gw0a3
   complexed with cl, cu, gol, man, nag, oxy, so4

Details for d2q9ob3

PDB Entry: 2q9o, 1.3 Å

PDB Description: near-atomic resolution structure of a melanocarpus albomyces laccase

PDB Compounds: (B:) Laccase-1

SCOPe Domain Sequences for d2q9ob3:

Sequence; same for both SEQRES and ATOM records:

>d2q9ob3 b.6.1.3 (B:344-559) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

Timeline for d2q9ob3:

• d2q9ob3 first appeared in SCOP 1.75
  
• d2q9ob3 appears in SCOPe 2.06
  
• d2q9ob3 appears in the current release, SCOPe 2.08