Lineage for d2q9na_ (2q9n A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450701Species Enterobacter cloacae [TaxId:550] [187307] (3 PDB entries)
  8. 1450704Domain d2q9na_: 2q9n A: [150148]
    automated match to d1blsa_
    complexed with lk5

Details for d2q9na_

PDB Entry: 2q9n (more details), 2.2 Å

PDB Description: 4-Substituted Trinems as Broad Spectrum-Lactamase Inhibitors: Structure-based Design, Synthesis and Biological Activity
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2q9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9na_ e.3.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOPe Domain Coordinates for d2q9na_:

Click to download the PDB-style file with coordinates for d2q9na_.
(The format of our PDB-style files is described here.)

Timeline for d2q9na_: