SCOPe 2.08: Domain d2q9na_: 2q9n A:

Lineage for d2q9na_ (2q9n A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Enterobacter cloacae [TaxId:550] [187307] (6 PDB entries)

8. Domain d2q9na_: 2q9n A: [150148]
   automated match to d1blsa_
   complexed with lk5

Details for d2q9na_

PDB Entry: 2q9n, 2.2 Å

PDB Description: 4-Substituted Trinems as Broad Spectrum-Lactamase Inhibitors: Structure-based Design, Synthesis and Biological Activity

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2q9na_:

Sequence; same for both SEQRES and ATOM records:

>d2q9na_ e.3.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

Timeline for d2q9na_:

• d2q9na_ first appeared in SCOP 1.75, called d2q9na1
  
• d2q9na_ appears in SCOPe 2.07