Lineage for d2q8za2 (2q8z A:1-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826890Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2826904Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (5 PDB entries)
  8. 2826905Domain d2q8za2: 2q8z A:1-323 [150133]
    Other proteins in same PDB: d2q8za3
    automated match to d2f84a1
    complexed with 7pe, nup, peg, so4

Details for d2q8za2

PDB Entry: 2q8z (more details), 1.8 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-phosphate decarboxylase complexed with 6-amino-UMP
PDB Compounds: (A:) orotidine-monophosphate-decarboxylase

SCOPe Domain Sequences for d2q8za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8za2 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnmes

SCOPe Domain Coordinates for d2q8za2:

Click to download the PDB-style file with coordinates for d2q8za2.
(The format of our PDB-style files is described here.)

Timeline for d2q8za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q8za3
View in 3D
Domains from other chains:
(mouse over for more information)
d2q8zb_