SCOPe 2.01: Domain d2q8ob_: 2q8o B:

Lineage for d2q8ob_ (2q8o B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
   Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173

8. Domain d2q8ob_: 2q8o B: [150130]
   automated match to d2q8oa1

Details for d2q8ob_

PDB Entry: 2q8o, 1.75 Å

PDB Description: crystal structure of mouse GITR ligand dimer

PDB Compounds: (B:) GITR ligand

SCOPe Domain Sequences for d2q8ob_:

Sequence; same for both SEQRES and ATOM records:

>d2q8ob_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
iescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnap
fvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpd
lpfis

Timeline for d2q8ob_:

• d2q8ob_ first appeared in SCOP 1.75, called d2q8ob1
  
• d2q8ob_ appears in SCOPe 2.02
  
• d2q8ob_ appears in the current release, SCOPe 2.08