Class b: All beta proteins [48724] (174 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries) Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173 |
Domain d2q8ob_: 2q8o B: [150130] automated match to d2q8oa1 |
PDB Entry: 2q8o (more details), 1.75 Å
SCOPe Domain Sequences for d2q8ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q8ob_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]} iescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnap fvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpd lpfis
Timeline for d2q8ob_: