Lineage for d2q8ia2 (2q8i A:177-301)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667864Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 1667870Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 1667871Species Human (Homo sapiens) [TaxId:9606] [160702] (5 PDB entries)
    Uniprot Q15120 177-301
  8. 1667877Domain d2q8ia2: 2q8i A:177-301 [150127]
    Other proteins in same PDB: d2q8ia1, d2q8ib_
    automatically matched to 1Y8N A:177-301
    complexed with gol, k, rdc, red

Details for d2q8ia2

PDB Entry: 2q8i (more details), 2.6 Å

PDB Description: pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d2q8ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8ia2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
npvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvy
vpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvplrk
idrlf

SCOPe Domain Coordinates for d2q8ia2:

Click to download the PDB-style file with coordinates for d2q8ia2.
(The format of our PDB-style files is described here.)

Timeline for d2q8ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q8ia1
View in 3D
Domains from other chains:
(mouse over for more information)
d2q8ib_