Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (2 families) |
Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein) |
Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species) N-terminal domain is a FAD-binding domain |
Species Escherichia coli [TaxId:562] [56197] (5 PDB entries) |
Domain d2q85a2: 2q85 A:201-342 [150119] Other proteins in same PDB: d2q85a1 automated match to d1mbba2 complexed with 973, fad |
PDB Entry: 2q85 (more details), 2.51 Å
SCOPe Domain Sequences for d2q85a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q85a2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]} vtpqqvfnavchmrttklpdpkvngnagsffknpvvsaetakallsqfptapnypqadgs vklaagwlidqcqlkgmqiggaavhrqqalvlinednaksedvvqlahhvrqkvgekfnv wlepevrfigasgevsavetis
Timeline for d2q85a2: