![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein) |
![]() | Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [56186] (5 PDB entries) |
![]() | Domain d2q85a1: 2q85 A:2-200 [150118] Other proteins in same PDB: d2q85a2 automated match to d1mbba1 complexed with 973, fad |
PDB Entry: 2q85 (more details), 2.51 Å
SCOPe Domain Sequences for d2q85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q85a1 d.145.1.2 (A:2-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} nhslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgt viinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqn igaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlp kewqpvltygdltrldptt
Timeline for d2q85a1: