Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries) Uniprot P01887 |
Domain d2q7yb1: 2q7y B:2-99 [150108] Other proteins in same PDB: d2q7ya1, d2q7ya2, d2q7yc1, d2q7yc2 automatically matched to d1qo3b_ complexed with bma, igc, man, nag, plm |
PDB Entry: 2q7y (more details), 1.95 Å
SCOP Domain Sequences for d2q7yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7yb1 b.1.1.2 (B:2-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d2q7yb1: