Lineage for d2q7yc2 (2q7y C:7-185)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856285Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 856301Species Mouse (Mus musculus) [TaxId:10090] [54457] (7 PDB entries)
  8. 856306Domain d2q7yc2: 2q7y C:7-185 [150110]
    Other proteins in same PDB: d2q7ya1, d2q7yb1, d2q7yc1, d2q7yd1
    automatically matched to d1cd1a2
    complexed with bma, igc, man, nag, plm

Details for d2q7yc2

PDB Entry: 2q7y (more details), 1.95 Å

PDB Description: Structure of the endogenous iNKT cell ligand iGb3 bound to mCD1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOP Domain Sequences for d2q7yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7yc2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOP Domain Coordinates for d2q7yc2:

Click to download the PDB-style file with coordinates for d2q7yc2.
(The format of our PDB-style files is described here.)

Timeline for d2q7yc2: