Lineage for d2q78g_ (2q78 G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646721Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
    contains extra C-terminal helix
  6. 1646728Protein Uncharacterized protein TM0581 [160186] (1 species)
  7. 1646729Species Thermotoga maritima [TaxId:2336] [160187] (1 PDB entry)
    Uniprot Q9WZ50 1-130
  8. 1646736Domain d2q78g_: 2q78 G: [150082]
    automated match to d2q78a1
    complexed with cl, mlc

Details for d2q78g_

PDB Entry: 2q78 (more details), 2.2 Å

PDB Description: crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution
PDB Compounds: (G:) Uncharacterized protein

SCOPe Domain Sequences for d2q78g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q78g_ d.38.1.7 (G:) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}
hmmdfdflegkrltedvaldetmvwnediemldlhlvatsaligvvhrvsyellsrylpn
dytavvvetlarhvkavptgtrvavgvrvvgvvgnrvkfrgivmsgdekileaefvraiv
preklrrlale

SCOPe Domain Coordinates for d2q78g_:

Click to download the PDB-style file with coordinates for d2q78g_.
(The format of our PDB-style files is described here.)

Timeline for d2q78g_: