![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
![]() | Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
![]() | Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
![]() | Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries) GDP-binding protein |
![]() | Domain d2q3za3: 2q3z A:586-683 [150039] Other proteins in same PDB: d2q3za1, d2q3za4 automatically matched to d1kv3a3 complexed with so4 |
PDB Entry: 2q3z (more details), 2 Å
SCOPe Domain Sequences for d2q3za3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag eevkvrmdlvplhmglhklvvnfesdklkavkgfrnvi
Timeline for d2q3za3: