Lineage for d2q3za3 (2q3z A:586-683)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763371Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
    GDP-binding protein
  8. 2763373Domain d2q3za3: 2q3z A:586-683 [150039]
    Other proteins in same PDB: d2q3za1, d2q3za4
    automatically matched to d1kv3a3
    complexed with so4

Details for d2q3za3

PDB Entry: 2q3z (more details), 2 Å

PDB Description: transglutaminase 2 undergoes large conformational change upon activation
PDB Compounds: (A:) Transglutaminase 2

SCOPe Domain Sequences for d2q3za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdlvplhmglhklvvnfesdklkavkgfrnvi

SCOPe Domain Coordinates for d2q3za3:

Click to download the PDB-style file with coordinates for d2q3za3.
(The format of our PDB-style files is described here.)

Timeline for d2q3za3: