Lineage for d2q3za4 (2q3z A:146-461)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155058Family d.3.1.4: Transglutaminase core [54044] (3 protein domains)
  6. 2155064Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2155102Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (4 PDB entries)
    GDP-binding protein
  8. 2155103Domain d2q3za4: 2q3z A:146-461 [150040]
    Other proteins in same PDB: d2q3za1, d2q3za2, d2q3za3
    automatically matched to d1kv3a4
    complexed with so4

Details for d2q3za4

PDB Entry: 2q3z (more details), 2 Å

PDB Description: transglutaminase 2 undergoes large conformational change upon activation
PDB Compounds: (A:) Transglutaminase 2

SCOPe Domain Sequences for d2q3za4:

Sequence, based on SEQRES records: (download)

>d2q3za4 d.3.1.4 (A:146-461) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfqdgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranh

Sequence, based on observed residues (ATOM records): (download)

>d2q3za4 d.3.1.4 (A:146-461) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfqdgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdsnllieyfrnsemiwnfhc
wveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdlstkydapfvfae
vnadvvdwiqksinrslivglkistksvgrderedithtykypegsseereaftranh

SCOPe Domain Coordinates for d2q3za4:

Click to download the PDB-style file with coordinates for d2q3za4.
(The format of our PDB-style files is described here.)

Timeline for d2q3za4: