SCOP 1.75: Domain d2q3za1: 2q3z A:15-145

Lineage for d2q3za1 (2q3z A:15-145)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (2 PDB entries)
   GDP-binding protein

8. Domain d2q3za1: 2q3z A:15-145 [150037]
   Other proteins in same PDB: d2q3za2, d2q3za3, d2q3za4
   automatically matched to d1kv3a1
   complexed with ace, nh2, onl, so4

Details for d2q3za1

PDB Entry: 2q3z, 2 Å

PDB Description: transglutaminase 2 undergoes large conformational change upon activation

PDB Compounds: (A:) Transglutaminase 2

SCOP Domain Sequences for d2q3za1:

Sequence; same for both SEQRES and ATOM records:

>d2q3za1 b.1.18.9 (A:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

Timeline for d2q3za1:

• d2q3za1 is new in SCOP 1.75
  
• d2q3za1 appears in SCOPe 2.01
  
• d2q3za1 appears in the current release, SCOPe 2.08