Lineage for d2q3za2 (2q3z A:472-585)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788243Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 788244Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 788245Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 788310Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (2 PDB entries)
    GDP-binding protein
  8. 788311Domain d2q3za2: 2q3z A:472-585 [150038]
    Other proteins in same PDB: d2q3za1, d2q3za4
    automatically matched to d1kv3a2
    complexed with ace, nh2, onl, so4

Details for d2q3za2

PDB Entry: 2q3z (more details), 2 Å

PDB Description: transglutaminase 2 undergoes large conformational change upon activation
PDB Compounds: (A:) Transglutaminase 2

SCOP Domain Sequences for d2q3za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3za2 b.1.5.1 (A:472-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
gmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkylln
ltlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

SCOP Domain Coordinates for d2q3za2:

Click to download the PDB-style file with coordinates for d2q3za2.
(The format of our PDB-style files is described here.)

Timeline for d2q3za2: