Lineage for d2q1ma1 (2q1m A:57-172)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779263Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 1779264Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 1779265Domain d2q1ma1: 2q1m A:57-172 [149998]

Details for d2q1ma1

PDB Entry: 2q1m (more details), 2.3 Å

PDB Description: crystal structure of human gitrl
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d2q1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1ma1 b.22.1.1 (A:57-172) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillan

SCOPe Domain Coordinates for d2q1ma1:

Click to download the PDB-style file with coordinates for d2q1ma1.
(The format of our PDB-style files is described here.)

Timeline for d2q1ma1: