Lineage for d2q1ma1 (2q1m A:57-172)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793693Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (2 species)
  7. 793694Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 793695Domain d2q1ma1: 2q1m A:57-172 [149998]

Details for d2q1ma1

PDB Entry: 2q1m (more details), 2.3 Å

PDB Description: crystal structure of human gitrl
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOP Domain Sequences for d2q1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1ma1 b.22.1.1 (A:57-172) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillan

SCOP Domain Coordinates for d2q1ma1:

Click to download the PDB-style file with coordinates for d2q1ma1.
(The format of our PDB-style files is described here.)

Timeline for d2q1ma1: