Lineage for d2q07a1 (2q07 A:460-527)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432835Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2432883Protein Uncharacterized protein AF0587 [159363] (1 species)
  7. 2432884Species Archaeoglobus fulgidus [TaxId:2234] [159364] (1 PDB entry)
    Uniprot O29668 460-527
  8. 2432885Domain d2q07a1: 2q07 A:460-527 [149981]
    Other proteins in same PDB: d2q07a2, d2q07a3

Details for d2q07a1

PDB Entry: 2q07 (more details), 2.04 Å

PDB Description: crystal structure of af0587, a protein of unknown function
PDB Compounds: (A:) Uncharacterized protein AF0587

SCOPe Domain Sequences for d2q07a1:

Sequence, based on SEQRES records: (download)

>d2q07a1 b.122.1.1 (A:460-527) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
ytveigdfevkgtifaggvlradekirpndvvvfhnsrifgvglaamsgkemagsekgia
invkrkfs

Sequence, based on observed residues (ATOM records): (download)

>d2q07a1 b.122.1.1 (A:460-527) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
ytveigdfevkgtifaggvlradekirpndvvvfhnsrifgvglaamsgkemagsgiain
vkrkfs

SCOPe Domain Coordinates for d2q07a1:

Click to download the PDB-style file with coordinates for d2q07a1.
(The format of our PDB-style files is described here.)

Timeline for d2q07a1: