SCOPe 2.07: Domain d2pyta1: 2pyt A:100-227

Lineage for d2pyta1 (2pyt A:100-227)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.24: EutQ-like [159304] (1 protein)
   Pfam PF06249

6. Protein Ethanolamine utilization protein EutQ [159305] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159306] (1 PDB entry)
   Uniprot Q9ZFV5 100-227

8. Domain d2pyta1: 2pyt A:100-227 [149957]

Details for d2pyta1

PDB Entry: 2pyt, 1.9 Å

PDB Description: crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution

PDB Compounds: (A:) Ethanolamine utilization protein eutQ

SCOPe Domain Sequences for d2pyta1:

Sequence; same for both SEQRES and ATOM records:

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]}
lelgtmqpsftsvtgkggvkvidgssvkfgrfdgaephcvgltdlvteqdgssmaagfmq
wdnaffpwtlnydeidmvlegelhvrhegetmiakagdvmfipkgssiefgtptsvrfly
vawpanwq

Timeline for d2pyta1:

• d2pyta1 first appeared in SCOP 1.75
  
• d2pyta1 appears in SCOPe 2.06
  
• d2pyta1 appears in the current release, SCOPe 2.08