Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.24: EutQ-like [159304] (1 protein) Pfam PF06249 |
Protein Ethanolamine utilization protein EutQ [159305] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [159306] (1 PDB entry) Uniprot Q9ZFV5 100-227 |
Domain d2pyta1: 2pyt A:100-227 [149957] |
PDB Entry: 2pyt (more details), 1.9 Å
SCOPe Domain Sequences for d2pyta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} lelgtmqpsftsvtgkggvkvidgssvkfgrfdgaephcvgltdlvteqdgssmaagfmq wdnaffpwtlnydeidmvlegelhvrhegetmiakagdvmfipkgssiefgtptsvrfly vawpanwq
Timeline for d2pyta1: