Lineage for d2pyoa_ (2pyo A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262431Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1262626Protein Histone H3 [47122] (6 species)
  7. 1262721Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (1 PDB entry)
  8. 1262722Domain d2pyoa_: 2pyo A: [149949]
    Other proteins in same PDB: d2pyob_, d2pyoc_, d2pyof_, d2pyog_
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn

Details for d2pyoa_

PDB Entry: 2pyo (more details), 2.43 Å

PDB Description: Drosophila nucleosome core
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d2pyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyoa_ a.22.1.1 (A:) Histone H3 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2pyoa_:

Click to download the PDB-style file with coordinates for d2pyoa_.
(The format of our PDB-style files is described here.)

Timeline for d2pyoa_: