Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species) |
Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries) Uniprot P03680 |
Domain d2pyla1: 2pyl A:5-187 [149947] Other proteins in same PDB: d2pyla2 automatically matched to d1xhxa1 protein/DNA complex; complexed with edo, mg, ttp |
PDB Entry: 2pyl (more details), 2.2 Å
SCOPe Domain Sequences for d2pyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyla1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg ldr
Timeline for d2pyla1: