Class b: All beta proteins [48724] (174 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
Protein Imidazolonepropionase [159348] (2 species) |
Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries) Uniprot Q8U8Z6 15-77,379-418 |
Domain d2puza1: 2puz A:17-79,A:381-420 [149873] Other proteins in same PDB: d2puza2, d2puzb2 complexed with cl, fe, mg, nig |
PDB Entry: 2puz (more details), 1.83 Å
SCOPe Domain Sequences for d2puza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2puza1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs
Timeline for d2puza1: