SCOPe 2.04: Domain d2pukb_: 2puk B:

Lineage for d2pukb_ (2puk B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)
   automatically mapped to Pfam PF02941

6. Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species)

7. Species Synechocystis sp. [TaxId:1143] [50100] (7 PDB entries)

8. Domain d2pukb_: 2puk B: [149862]
   Other proteins in same PDB: d2puka_, d2pukc_, d2puke_, d2pukg_
   automated match to d2pu9b_
   complexed with sf4

Details for d2pukb_

PDB Entry: 2puk, 3 Å

PDB Description: crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m

PDB Compounds: (B:) Ferredoxin-thioredoxin reductase, variable chain

SCOPe Domain Sequences for d2pukb_:

Sequence; same for both SEQRES and ATOM records:

>d2pukb_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtli

Timeline for d2pukb_:

• d2pukb_ first appeared in SCOP 1.75, called d2pukb1
  
• d2pukb_ was called d2pukb1 in SCOPe 2.03
  
• d2pukb_ appears in SCOPe 2.05
  
• d2pukb_ appears in the current release, SCOPe 2.08