SCOPe 2.01: Domain d2pt7a_: 2pt7 A:

Lineage for d2pt7a_ (2pt7 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
   type II/IV secretion system protein; includes N-terminal alpha+beta domain of a profilin-like topology

7. Species Helicobacter pylori [TaxId:210] [52720] (5 PDB entries)

8. Domain d2pt7a_: 2pt7 A: [149834]
   automated match to d1g6oa_

Details for d2pt7a_

PDB Entry: 2pt7, 2.4 Å

PDB Description: Crystal structure of Cag VirB11 (HP0525) and an inhibitory protein (HP1451)

PDB Compounds: (A:) Cag-alfa

SCOPe Domain Sequences for d2pt7a_:

Sequence; same for both SEQRES and ATOM records:

>d2pt7a_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik

Timeline for d2pt7a_:

• d2pt7a_ first appeared in SCOP 1.75, called d2pt7a1
  
• d2pt7a_ appears in SCOPe 2.02
  
• d2pt7a_ appears in the current release, SCOPe 2.08