Class a: All alpha proteins [46456] (284 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein Uncharacterized protein Reut_A2532 [158825] (1 species) |
Species Ralstonia eutropha [TaxId:106590] [158826] (1 PDB entry) Uniprot Q46Y90 5-194 |
Domain d2prrl_: 2prr L: [149814] automated match to d2prra1 complexed with peg, pge |
PDB Entry: 2prr (more details), 2.15 Å
SCOPe Domain Sequences for d2prrl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prrl_ a.152.1.3 (L:) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]} ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd efflmgrvp
Timeline for d2prrl_: