Lineage for d2ppna_ (2ppn A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1199824Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1199825Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1199836Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1199840Species Human (Homo sapiens) [TaxId:9606] [54537] (41 PDB entries)
  8. 1199896Domain d2ppna_: 2ppn A: [149781]
    automated match to d1a7xa_

Details for d2ppna_

PDB Entry: 2ppn (more details)

PDB Description: Crystal structure of FKBP12
PDB Compounds: (A:) FK506-binding protein 1A

SCOPe Domain Sequences for d2ppna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppna_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d2ppna_:

Click to download the PDB-style file with coordinates for d2ppna_.
(The format of our PDB-style files is described here.)

Timeline for d2ppna_: