SCOPe 2.08: Domain d2ppfa1: 2ppf A:4-166

Lineage for d2ppfa1 (2ppf A:4-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries)
   Uniprot P38501

8. Domain d2ppfa1: 2ppf A:4-166 [149775]
   Other proteins in same PDB: d2ppfa2, d2ppfb2, d2ppfc2
   automated match to d1j9qa1
   complexed with act, cu, cu1, no, trs; mutant

Details for d2ppfa1

PDB Entry: 2ppf, 1.65 Å

PDB Description: reduced mutant d98n of afnir exposed to nitric oxide

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2ppfa1:

Sequence; same for both SEQRES and ATOM records:

>d2ppfa1 b.6.1.3 (A:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

Timeline for d2ppfa1:

• d2ppfa1 first appeared in SCOP 1.75
  
• d2ppfa1 appears in SCOPe 2.07