![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
![]() | Domain d2ppec1: 2ppe C:4-166 [149773] Other proteins in same PDB: d2ppea2, d2ppeb2, d2ppec2 automated match to d1npna1 complexed with act, cu, cu1, no, trs; mutant |
PDB Entry: 2ppe (more details), 1.75 Å
SCOPe Domain Sequences for d2ppec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppec1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgk
Timeline for d2ppec1:
![]() Domains from other chains: (mouse over for more information) d2ppea1, d2ppea2, d2ppeb1, d2ppeb2 |