Lineage for d2pnkh1 (2pnk H:1-421)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817064Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 817065Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 817066Species Bacillus halodurans [TaxId:86665] [159396] (2 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 817075Domain d2pnkh1: 2pnk H:1-421 [149679]
    automatically matched to 2PNK A:1-423
    complexed with act, cl, fmt, gol, mpd, na, po4, unl

Details for d2pnkh1

PDB Entry: 2pnk (more details), 2 Å

PDB Description: crystal structure of an uronate isomerase (bh0493) from bacillus halodurans c-125 at 2.00 a resolution
PDB Compounds: (H:) BH0493 protein

SCOP Domain Sequences for d2pnkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnkh1 c.1.9.8 (H:1-421) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
v

SCOP Domain Coordinates for d2pnkh1:

Click to download the PDB-style file with coordinates for d2pnkh1.
(The format of our PDB-style files is described here.)

Timeline for d2pnkh1: