Lineage for d2pnkb_ (2pnk B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971885Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 971886Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 971887Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 971901Domain d2pnkb_: 2pnk B: [149675]
    automated match to d2pnka1
    complexed with act, cl, fmt, gol, mpd, na, po4, unl

Details for d2pnkb_

PDB Entry: 2pnk (more details), 2 Å

PDB Description: crystal structure of an uronate isomerase (bh0493) from bacillus halodurans c-125 at 2.00 a resolution
PDB Compounds: (B:) BH0493 protein

SCOPe Domain Sequences for d2pnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnkb_ c.1.9.8 (B:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
vkv

SCOPe Domain Coordinates for d2pnkb_:

Click to download the PDB-style file with coordinates for d2pnkb_.
(The format of our PDB-style files is described here.)

Timeline for d2pnkb_: