SCOPe 2.04: Domain d2pmka_: 2pmk A:

Lineage for d2pmka_ (2pmk A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Haemolysin B ATP-binding protein [89683] (1 species)

7. Species Escherichia coli [TaxId:562] [89684] (3 PDB entries)

8. Domain d2pmka_: 2pmk A: [149669]
   automated match to d2pmka1
   complexed with 128, adp

Details for d2pmka_

PDB Entry: 2pmk, 1.6 Å

PDB Description: crystal structures of an isolated abc-atpase in complex with tnp-adp

PDB Compounds: (A:) Alpha-hemolysin translocation ATP-binding protein hlyB

SCOPe Domain Sequences for d2pmka_:

Sequence; same for both SEQRES and ATOM records:

>d2pmka_ c.37.1.12 (A:) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}
hhditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipeng
qvlidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklaga
hdfiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvi
mrnmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyql
qsd

Timeline for d2pmka_:

• d2pmka_ first appeared in SCOP 1.75, called d2pmka1
  
• d2pmka_ appears in SCOPe 2.03
  
• d2pmka_ appears in SCOPe 2.05
  
• d2pmka_ appears in the current release, SCOPe 2.08, called d2pmka2