SCOPe 2.07: Domain d2plsj2: 2pls J:346-428

Lineage for d2plsj2 (2pls J:346-428)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Hypothetical protein CT0541 [160823] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry)
   Uniprot Q8KEZ1 345-428

8. Domain d2plsj2: 2pls J:346-428 [149647]
   Other proteins in same PDB: d2plsa2, d2plsb3, d2plsc3, d2plsd3, d2plse3, d2plsf3, d2plsg3, d2plsh3, d2plsi3, d2plsj3, d2plsk3, d2plsl3
   automated match to d2plsi_
   complexed with act, edo, fmt, mg

Details for d2plsj2

PDB Entry: 2pls, 2.15 Å

PDB Description: structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls

PDB Compounds: (J:) CBS domain protein

SCOPe Domain Sequences for d2plsj2:

Sequence; same for both SEQRES and ATOM records:

>d2plsj2 d.145.1.4 (J:346-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]}
vqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfwe
nwrlevidmdskridkvlatkid

Timeline for d2plsj2:

• d2plsj2 first appeared in SCOP 1.75, called d2plsj1
  
• d2plsj2 appears in SCOPe 2.06
  
• d2plsj2 appears in the current release, SCOPe 2.08