Lineage for d2plfa1 (2plf A:207-320)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402558Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2402693Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 2402702Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 2402711Domain d2plfa1: 2plf A:207-320 [149625]
    Other proteins in same PDB: d2plfa2, d2plfa3
    automated match to d2ahoa1

Details for d2plfa1

PDB Entry: 2plf (more details), 2.9 Å

PDB Description: The structure of aIF2gamma subunit from the archaeon Sulfolobus solfataricus in the nucleotide-free form.
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2plfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plfa1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d2plfa1:

Click to download the PDB-style file with coordinates for d2plfa1.
(The format of our PDB-style files is described here.)

Timeline for d2plfa1: