Class b: All beta proteins [48724] (174 folds) |
Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily) core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection |
Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) automatically mapped to Pfam PF06766 |
Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins) a self-assembling amphiphile |
Protein Hydrophobin II, HfbII [101753] (1 species) |
Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries) |
Domain d2pl7b_: 2pl7 B: [149621] automated match to d1r2ma_ complexed with htg, so4 |
PDB Entry: 2pl7 (more details), 1 Å
SCOPe Domain Sequences for d2pl7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pl7b_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]} avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq allcqka
Timeline for d2pl7b_: