Lineage for d2pl7b_ (2pl7 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412252Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 2412253Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families) (S)
    automatically mapped to Pfam PF06766
  5. 2412254Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 protein domains)
    a self-assembling amphiphile
  6. 2412255Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 2412256Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)
  8. 2412262Domain d2pl7b_: 2pl7 B: [149621]
    automated match to d1r2ma_
    complexed with htg, so4

Details for d2pl7b_

PDB Entry: 2pl7 (more details), 1 Å

PDB Description: Orhorhombic crystal structure of hydrophobin HFBII in the presence of a detergent
PDB Compounds: (B:) Hydrophobin-2

SCOPe Domain Sequences for d2pl7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pl7b_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqka

SCOPe Domain Coordinates for d2pl7b_:

Click to download the PDB-style file with coordinates for d2pl7b_.
(The format of our PDB-style files is described here.)

Timeline for d2pl7b_: