SCOPe 2.04: Domain d2pl7a_: 2pl7 A:

Lineage for d2pl7a_ (2pl7 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
   core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection

4. Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family)
   automatically mapped to Pfam PF06766

5. Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
   a self-assembling amphiphile

6. Protein Hydrophobin II, HfbII [101753] (1 species)

7. Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)

8. Domain d2pl7a_: 2pl7 A: [149620]
   automated match to d1r2ma_
   complexed with htg, so4

Details for d2pl7a_

PDB Entry: 2pl7, 1 Å

PDB Description: orhorhombic crystal structure of hydrophobin hfbii in the presence of a detergent

PDB Compounds: (A:) Hydrophobin-2

SCOPe Domain Sequences for d2pl7a_:

Sequence; same for both SEQRES and ATOM records:

>d2pl7a_ b.138.1.1 (A:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqka

Timeline for d2pl7a_:

• d2pl7a_ first appeared in SCOP 1.75, called d2pl7a1
  
• d2pl7a_ appears in SCOPe 2.03
  
• d2pl7a_ appears in SCOPe 2.05
  
• d2pl7a_ appears in the current release, SCOPe 2.08