SCOP 1.75: Domain d2pkxb1: 2pkx B:1-119

Lineage for d2pkxb1 (2pkx B:1-119)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein PhoP receiver domain [82340] (2 species)

7. Species Escherichia coli [TaxId:562] [159479] (2 PDB entries)
   Uniprot P23836 1-119

8. Domain d2pkxb1: 2pkx B:1-119 [149607]
   automatically matched to 2PKX A:1-119
   mutant

Details for d2pkxb1

PDB Entry: 2pkx, 2.54 Å

PDB Description: e.coli response regulator phop receiver domain

PDB Compounds: (B:) Transcriptional regulatory protein phoP

SCOP Domain Sequences for d2pkxb1:

Sequence; same for both SEQRES and ATOM records:

>d2pkxb1 c.23.1.1 (B:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}
mrvlvvednallrhhlkvqiqdaghqvddaedakeadyylnehipdiaivdlglpdedgl
slirrwrsndvslpilvltareswqdkvevlsagaddyvtkpfhieevmarmqalmrrn

Timeline for d2pkxb1:

• d2pkxb1 is new in SCOP 1.75
  
• d2pkxb1 is called d2pkxb_ in SCOPe 2.01
  
• d2pkxb1 appears in the current release, SCOPe 2.08, called d2pkxb_