Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein PhoP receiver domain [82340] (2 species) |
Species Escherichia coli [TaxId:562] [159479] (2 PDB entries) Uniprot P23836 1-119 |
Domain d2pkxa1: 2pkx A:1-119 [149606] mutant |
PDB Entry: 2pkx (more details), 2.54 Å
SCOP Domain Sequences for d2pkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkxa1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} mrvlvvednallrhhlkvqiqdaghqvddaedakeadyylnehipdiaivdlglpdedgl slirrwrsndvslpilvltareswqdkvevlsagaddyvtkpfhieevmarmqalmrrn
Timeline for d2pkxa1: