SCOPe 2.08: Domain d2pesa1: 2pes A:1-136

Lineage for d2pesa1 (2pes A:1-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (16 species)
   not a true protein

7. Species Aspergillus flavus [TaxId:5059] [226800] (5 PDB entries)

8. Domain d2pesa1: 2pes A:1-136 [149445]
   automated match to d2yzca1
   complexed with aza, lu, pdc

Details for d2pesa1

PDB Entry: 2pes, 1.6 Å

PDB Description: Urate Oxidase in complex with tris-dipicolinate Lutetium

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d2pesa1:

Sequence; same for both SEQRES and ATOM records:

>d2pesa1 d.96.1.0 (A:1-136) automated matches {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

Timeline for d2pesa1:

• d2pesa1 first appeared in SCOP 1.75
  
• d2pesa1 appears in SCOPe 2.07