Lineage for d2peja1 (2pej A:3-111)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739028Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2739029Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2739035Species Synechococcus sp. pcc 7002 [TaxId:32049] [158618] (6 PDB entries)
    Uniprot Q44177 2-111! Uniprot Q44177 3-109! Uniprot Q44177 3-111
  8. 2739063Domain d2peja1: 2pej A:3-111 [149417]
    mutant

Details for d2peja1

PDB Entry: 2pej (more details), 3.4 Å

PDB Description: crystal structure of rbcx point mutant y17a/y20l
PDB Compounds: (A:) orf134

SCOPe Domain Sequences for d2peja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peja1 a.280.1.1 (A:3-111) RuBisCo chaperone RbcX {Synechococcus sp. pcc 7002 [TaxId: 32049]}
fkkvaketaitlqsaltlqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq

SCOPe Domain Coordinates for d2peja1:

Click to download the PDB-style file with coordinates for d2peja1.
(The format of our PDB-style files is described here.)

Timeline for d2peja1: